BLASTP 2.2.31+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /home/ubuntu/.blastDB_temp/Mitochondria_Public_s_aa
           9,177 sequences; 2,445,780 total letters



Query= input

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GI:23505441  | GI:23505441 | ORF329 | 30656:31645 Forward             680     0.0   
ScpofMp03  | ScpofMp03 | hypothetical protein | 6845:7817 Forward     302     4e-101
ANID_20016  | ANID_20016 | LAGLIDADG endonuclease | 29265:30164 F...  285     7e-95 
Fusom_p18  | cox1-i6 | LAGLIDADG intron encoded protein | 40036:4...  274     2e-90 
ScjafMp04  | orf307 | orf307 | 19371:20294 Forward                    268     6e-88 
H915_p12  | orf331 | hypothetical protein | 41523:42518 Forward       245     7e-79 
I510p17  | oi5cox1 | intronic ORF at intron 5 of cox1 | 62666:636...  231     2e-73 
SmcufMp25  | orf279 | orf279 | 48570:49409 Forward                    192     5e-59 
SmcufMp27  | orf307 | orf307 | 51016:51939 Forward                    187     9e-57 
GI:49147213  | orf330 | putative site-specific DNA endonuclease |...  174     2e-51 


>GI:23505441 | GI:23505441 | ORF329 | 30656:31645 Forward
Length=329

 Score = 680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%), Gaps = 0/329 (0%)

Query  1    GCLSLQLLQFAGRTCKHRFSYFKFTNKVKMLNQMSQSAGKSRAFSSSACTSETLSNKITT  60
            GCLSLQLLQFAGRTCKHRFSYFKFTNKVKMLNQMSQSAGKSRAFSSSACTSETLSNKITT
Sbjct  1    GCLSLQLLQFAGRTCKHRFSYFKFTNKVKMLNQMSQSAGKSRAFSSSACTSETLSNKITT  60

Query  61   DNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSGVEIAFHSADHLLAHYIKTRL  120
            DNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSGVEIAFHSADHLLAHYIKTRL
Sbjct  61   DNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSGVEIAFHSADHLLAHYIKTRL  120

Query  121  GHGKISEVKGKNAIVLRFGLDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNNL  180
            GHGKISEVKGKNAIVLRFGLDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNNL
Sbjct  121  GHGKISEVKGKNAIVLRFGLDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNNL  180

Query  181  DLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRTEVRLNYQVDQKYDYLLKLIQKEL  240
            DLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRTEVRLNYQVDQKYDYLLKLIQKEL
Sbjct  181  DLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRTEVRLNYQVDQKYDYLLKLIQKEL  240

Query  241  GGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRHLT  300
            GGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRHLT
Sbjct  241  GGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRHLT  300

Query  301  PKGLEELAESKSSIAKLEEIRKTYSLEND  329
            PKGLEELAESKSSIAKLEEIRKTYSLEND
Sbjct  301  PKGLEELAESKSSIAKLEEIRKTYSLEND  329


>ScpofMp03 | ScpofMp03 | hypothetical protein | 6845:7817 Forward
Length=323

 Score = 302 bits (773),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 221/319 (69%), Gaps = 21/319 (7%)

Query  2    CLSLQLLQFAGRTCK--HRFSYFKFTNK---------VKMLNQMSQSAGKSRAFSSSACT  50
             + L  L +AG T K   +   FK++ K         VKML Q+S SAG       +  T
Sbjct  2    LIGLLTLLYAGTTWKILDKSFCFKYSKKNTRLVFIFIVKMLKQLSISAGNLL----NKGT  57

Query  51   SETLSNKITTDNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFS-KSGVEIAFHSAD  109
            SETL N+ITT   K VS H  KH+KP ND++FG+YLAGLIDGDGHFS K  + IAFHS D
Sbjct  58   SETLRNEITT---KKVSIHLPKHLKPANDSQFGHYLAGLIDGDGHFSSKQQLIIAFHSLD  114

Query  110  HLLAHYIKTRLGHGKISEVKGKNAIVLRFG-LDGTKEVITLINNKFRTHHRFEQIEKNLF  168
              LA+YIK ++G+G + ++K KNAI+       G + VITLINNKFRT  ++ QI  N+F
Sbjct  115  IQLAYYIKKQIGYGIVRKIKDKNAILFIIANSKGIERVITLINNKFRTTSKYNQIINNIF  174

Query  169  TKPSFSNFCNNLDLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRTEVRLNYQVDQK  228
              P F  F   + L L+ + NL+N+WL+GFSDADASFQIKIL R   + EVRLNYQ+DQK
Sbjct  175  AHPRFKEFSKTITLGLNSNNNLNNHWLAGFSDADASFQIKILNRD-KKIEVRLNYQIDQK  233

Query  229  YDYLLKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRR  288
             +YLL LI+  LGGNIG+RKSQDTYYYGSTSF +A KVI YFD YHL+S+K ISYL+WR+
Sbjct  234  KEYLLSLIKDNLGGNIGYRKSQDTYYYGSTSFGSAKKVINYFDNYHLLSSKYISYLKWRK  293

Query  289  AYLIIQDRRHLTPKGLEEL  307
            AYLIIQ+ +HLT  GL ++
Sbjct  294  AYLIIQENKHLTESGLSQI  312


>ANID_20016 | ANID_20016 | LAGLIDADG endonuclease | 29265:30164 Forward
Length=299

 Score = 285 bits (730),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 204/288 (71%), Gaps = 19/288 (7%)

Query  50   TSETLSNKIT--TDNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHF-SKSGVEIAFH  106
            TSETL N+I   T+N K +S H  KH+KP++D +FG+YLAGLIDGDGHF SK  + IAFH
Sbjct  10   TSETLCNEIVVNTENIKSISVHVPKHLKPVSDDQFGHYLAGLIDGDGHFNSKQQLVIAFH  69

Query  107  SADHLLAHYIKTRLGHGKISEVKGKNAIVLRF-GLDGTKEVITLINNKFRTHHRFEQIEK  165
            S D  LA+YIK RLG+G + +VK KNA +L     +G ++VI LIN K RT ++F QI  
Sbjct  70   SLDVSLAYYIKKRLGYGSVKKVKNKNAFILVVTAREGIEKVINLINGKIRTENKFNQITN  129

Query  166  NLFTKPSFSNFCNNLDLSLDKSENLDNYWLSGFSDADAS--------------FQIKILK  211
            N+    +++ F   + L L+ S N  N+WL+GFSDADAS              FQIKIL 
Sbjct  130  NILNHENYAEFSKKISLKLNLSNNFKNHWLAGFSDADASGAGLHPGCVSPKASFQIKILN  189

Query  212  RSLTRTEVRLNYQVDQKYDYLLKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFD  271
            R+  + EVRLN+Q+DQK +Y+L LI++ LGGNIG+RKSQDTYYYGSTSF +A  VI YFD
Sbjct  190  RN-KKIEVRLNFQIDQKKEYILLLIKEFLGGNIGYRKSQDTYYYGSTSFGSAKNVINYFD  248

Query  272  KYHLMSTKLISYLRWRRAYLIIQDRRHLTPKGLEELAESKSSIAKLEE  319
             +HL+S+K ++YL+WR+AYLIIQ++ HL   GLE++ + KS++ ++ +
Sbjct  249  YFHLLSSKHVNYLKWRKAYLIIQNKDHLNNDGLEKIIKLKSTMNRVND  296


>Fusom_p18 | cox1-i6 | LAGLIDADG intron encoded protein | 40036:40980 Forward
Length=314

 Score = 274 bits (701),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 213/318 (67%), Gaps = 11/318 (3%)

Query  2    CLSLQLLQFAGRTCKHRFSYFKFTNKVKMLNQMSQSAGKSRAFSSSACTSETLSNKITTD  61
             +SL +L +AG      F Y    +KVK L Q SQSAG +      + TSET+ +   T+
Sbjct  2    VISLLMLLYAGNASLTSFKYSLLIDKVKKLKQWSQSAGNTL----KSGTSETIRD--NTE  55

Query  62   NPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFS-KSGVEIAFHSADHLLAHYIKTRL  120
            N K +S H   H+KP+ND +FG+YLAGLIDGDGHFS +  + I F S D  LA+YIK+ +
Sbjct  56   NLKNISIHVPTHLKPLNDKQFGHYLAGLIDGDGHFSSQQQLVIVFSSPDVQLAYYIKSII  115

Query  121  GHGKISEVKGKNA-IVLRFGLDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNN  179
            G G + +VK KNA + +    DG   VI LIN+K RT ++F Q+  N+     +S    +
Sbjct  116  GFGNVKQVKDKNAYLYIISNKDGMLRVINLINSKLRTINKFNQVINNILAHSKYSK--ES  173

Query  180  LDLSLDKSENLDNYWLSGFSDADASFQIKILKR-SLTRTEVRLNYQVDQKYDYLLKLIQK  238
            ++  ++ S +  N+WL+GFSDADASFQIKI+ R +  R E+RLN+Q+DQK   +L  ++ 
Sbjct  174  IEFKINDSNDFHNHWLAGFSDADASFQIKIINRMNKPRPEIRLNFQIDQKDKNVLFWLKG  233

Query  239  ELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRH  298
              GGNIG+R+SQDTYYYGSTSF +A+KVI+YFD +HL S+K I+YL+WR+ Y++IQ+R H
Sbjct  234  LFGGNIGYRESQDTYYYGSTSFGSALKVIRYFDNFHLQSSKYINYLKWRKTYILIQERHH  293

Query  299  LTPKGLEELAESKSSIAK  316
            LT  G++++ + K S+ +
Sbjct  294  LTEIGIDKIMKLKKSMNR  311


>ScjafMp04 | orf307 | orf307 | 19371:20294 Forward
Length=307

 Score = 268 bits (684),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 181/247 (73%), Gaps = 10/247 (4%)

Query  72   KHVKPMNDTEFGYYLAGLIDGDGHFSKSGVEIAFHSADHLLAHYIKTRLGHGKISEVKGK  131
            K + P ND EFG+YLAGLIDGDGHFS S   I F+ AD  LA+Y++ RLG G + +VK K
Sbjct  46   KLILPKNDIEFGHYLAGLIDGDGHFS-SRFSICFNIADSHLAYYLQRRLGFGYVYKVKDK  104

Query  132  NAIVLRFGLD---GTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNNLDLSLDK--  186
            NA+   F +    G + VI+LIN KFRT  +F+Q+ + L   P F+ F   + LSL+K  
Sbjct  105  NAV--NFTVSDRLGIEIVISLINGKFRTESKFKQLTR-LLEAPKFNRFSKTIKLSLNKGT  161

Query  187  -SENLDNYWLSGFSDADASFQIKILKRSLTRTEVRLNYQVDQKYDYLLKLIQKELGGNIG  245
              ++ DNYWL+GFSDADASFQIK++KRS +RTEVRLNYQVDQK DYLL +I+   GG +G
Sbjct  162  SPKDFDNYWLAGFSDADASFQIKLVKRSASRTEVRLNYQVDQKTDYLLCMIKNLFGGYVG  221

Query  246  HRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRHLTPKGLE  305
            HR SQ+T YYGSTS+ +A KV+KYFD YH++STK I+YL+WR+ Y +I+  +HLTPKGL+
Sbjct  222  HRGSQNTAYYGSTSYTSADKVVKYFDHYHMLSTKFINYLQWRKVYTLIKTHQHLTPKGLK  281

Query  306  ELAESKS  312
             + + KS
Sbjct  282  RIQKIKS  288


>H915_p12 | orf331 | hypothetical protein | 41523:42518 Forward
Length=331

 Score = 245 bits (626),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 195/296 (66%), Gaps = 16/296 (5%)

Query  28   VKMLNQMSQSAGKSRAFSSSACTSETLSNKITTDNPKLVSEHPKKHVKPMNDTEFGYYLA  87
            V  L   SQSAG +  +     TSETLSN+     P  +  H     KP+ D +FG+YLA
Sbjct  44   VTKLKHRSQSAG-NFGYLIYKRTSETLSNE-----PNKIFVHTT--TKPVKDNDFGHYLA  95

Query  88   GLIDGDGHFSKSG-VEIAFHSADHLLAHYIKTRLGHGKISEVKGKNAIVLRFG-LDGTKE  145
            GLI+GDGHFSK+  + I F+  D  LA+YIK R+G G I +VK K A++L    L G K+
Sbjct  96   GLIEGDGHFSKTPQIVIVFNFLDASLAYYIKGRVGFGNIYKVKHKKAVILVISKLAGIKK  155

Query  146  VITLINNKFRTHHRFEQIEKNLFTKPSFSNFCNNLDLSLDKSENLDNYWLSGFSDADASF  205
            V+ LIN K R+  + +QI  N+   P F   C+    S   +  LDN+W+SGFSDAD+SF
Sbjct  156  VLNLINGKIRSQIKIDQINNNILIHPYFKE-CDPFSSS---TLGLDNHWISGFSDADSSF  211

Query  206  QIKILKRSL--TRTEVRLNYQVDQKYDYLLKLIQKELGGNIGHRKSQDTYYYGSTSFVNA  263
            QIK++ R     +TEVRLN+Q+DQK   LL L++   GGNIG+RK+QDTYYYGSTSF +A
Sbjct  212  QIKLISRKDRDNKTEVRLNFQIDQKKIDLLLLMKNYFGGNIGYRKTQDTYYYGSTSFGSA  271

Query  264  VKVIKYFDKYHLMSTKLISYLRWRRAYLIIQDRRHLTPKGLEELAESKSSIAKLEE  319
             KVI+YFD + L+S+K ++YL+W++AY IIQ+  HL   G+E++ + K+S+ +L +
Sbjct  272  KKVIEYFDNFQLLSSKHVNYLKWKKAYTIIQNTEHLNASGIEKILKIKNSLNRLND  327


>I510p17 | oi5cox1 | intronic ORF at intron 5 of cox1 | 62666:63622 Forward
Length=318

 Score = 231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/323 (41%), Positives = 204/323 (63%), Gaps = 21/323 (7%)

Query  3    LSLQLLQFAGRTCKHRFSYFKFTNKVKMLNQMSQSAGKSRAF---SSSACTSETLSNKIT  59
            +SL +L +AG+   + F Y+ F + VK L + SQSAG ++ F        TSET+ +   
Sbjct  1    MSLVMLLYAGKASMYSFKYYIFIDTVKKLKRWSQSAGNTQFFFLKKKIGGTSETICD--N  58

Query  60   TDNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHF-SKSGVEIAFHSADHLLAHYIKT  118
            T+N K +S H   H+KP+ND +FG+YLAGLIDG G+F ++  + I F S+D  LA+YIK+
Sbjct  59   TENIKNISIHVPTHLKPLNDEQFGHYLAGLIDGKGYFNTQQQLIIEFSSSDVKLAYYIKS  118

Query  119  RLGHGKISEVKGKNAIVL----RFGLDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFS  174
             +G G++ +VK KN  +     +FG+  T   I LIN K R   +F Q   N+ T     
Sbjct  119  MIGFGQVKKVKDKNVYIYIISNKFGIIKT---INLINGKLRIIDKFNQDIDNILT-----  170

Query  175  NFCNNLDLSLDKSENL--DNYWLSGFSDADASFQIKIL-KRSLTRTEVRLNYQVDQKYDY  231
            N   N++   + S NL   NYW++GFSDA ASFQI+I+ K +  + E+RLN + D++   
Sbjct  171  NLKENIEFKFNDSNNLINGNYWITGFSDAGASFQIEIVNKINEPKPEIRLNLKFDKQDKN  230

Query  232  LLKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYL  291
            +L LI++  GG I + K  ++Y Y S SF +A K++ YFD +HL S K ++YL+WR+AY+
Sbjct  231  VLILIKEVFGGIISYEKLNNSYTYNSNSFGSARKILNYFDNFHLQSNKYVNYLKWRKAYI  290

Query  292  IIQDRRHLTPKGLEELAESKSSI  314
            I+Q++ +LT +G++++ + K+SI
Sbjct  291  IVQEKNYLTERGMDKIIKLKNSI  313


>SmcufMp25 | orf279 | orf279 | 48570:49409 Forward
Length=279

 Score = 192 bits (488),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 155/256 (61%), Gaps = 30/256 (12%)

Query  62   NPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSG--VEIAFHSADHLLAHYIKTR  119
            N   +S+H   H KP+ND +FGYYLAGLI+GDG  +K    + I F+  D  LA+YIK +
Sbjct  13   NLSTISDHVPIHKKPLNDNDFGYYLAGLIEGDGSINKINPYISICFYELDTPLAYYIKKK  72

Query  120  LGHGKISEVKGKNAIV--LRFGLDGTKEVITLINNKFRT-----------HHRFEQIEKN  166
            +G+G I ++K K AI   LR   DG   +I LIN K RT           H   E+ +K 
Sbjct  73   IGYGTILKIKNKRAINYHLRHK-DGIIRLIDLINGKLRTNKIIDWNTYIIHKINEKYDKT  131

Query  167  LFTKPSFSNFCNNLDLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRT--EVRLNYQ  224
             F              ++D S   +NYWL+GF+D+D SFQIK +KR+  +   E+RL+YQ
Sbjct  132  YFK------------YNIDNSNLKNNYWLAGFTDSDGSFQIKTIKRNNKKNNYEIRLSYQ  179

Query  225  VDQKYDYLLKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYL  284
            +DQK D++L  I++   G +G R   +TYY+ + SF +A KVIKY D YHL+S+K ++YL
Sbjct  180  IDQKTDHILNQIKELFSGYLGFRSKLNTYYFQTVSFSSAYKVIKYLDNYHLLSSKYLNYL  239

Query  285  RWRRAYLIIQDRRHLT  300
            +WR+ YL IQ R HLT
Sbjct  240  KWRKTYLYIQKREHLT  255


>SmcufMp27 | orf307 | orf307 | 51016:51939 Forward
Length=307

 Score = 187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/262 (42%), Positives = 160/262 (61%), Gaps = 12/262 (5%)

Query  58   ITTDNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSGVEIAFHSADHLLAHYIK  117
            I  ++ K +S+H  KH  P +D +FGYYLAGLI+GDG+F K  +EI F+  D  LA++IK
Sbjct  51   INVEDIKNISDHMNKHSYPESDNDFGYYLAGLIEGDGYFGKLALEIIFNEKDISLAYFIK  110

Query  118  TRLGHGKISEVKGKNAIVLRFGL---DGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFS  174
             ++G+G I ++K K A   ++ L   +G K+V+ L N KF T+++ +Q+ K  +      
Sbjct  111  KKIGYGNIYKIKNKKA--YKYYLSHKEGLKKVLDLTNGKFITNNKIDQLIKYSYNTKFSL  168

Query  175  NFCNNLDLSLDKSENLDNYWLSGFSDADASFQIKILKRSLTRTE--VRLNYQVDQKYDYL  232
            N       SL     L NYWL+GFSDAD+SF I I K S  + +  VRL +++ QK   +
Sbjct  169  NIKPPASFSL-----LKNYWLAGFSDADSSFCITIAKSSTHKLKYSVRLEFKIKQKDPTI  223

Query  233  LKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYLI  292
            LK I KE GGN+    +++ Y Y ST+F  A  +I YFD YHL S+K   Y RWR+AY I
Sbjct  224  LKKIFKEFGGNLNIFNTENIYCYNSTNFKVAKNIINYFDNYHLNSSKYREYFRWRKAYRI  283

Query  293  IQDRRHLTPKGLEELAESKSSI  314
            IQ + HLT  GL ++ + K ++
Sbjct  284  IQRKEHLTLTGLIKILKLKKNL  305


>GI:49147213 | orf330 | putative site-specific DNA endonuclease | 77091:78083 
Forward
Length=330

 Score = 174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 154/266 (58%), Gaps = 18/266 (7%)

Query  61   DNPKLVSEHPKKHVKPMNDTEFGYYLAGLIDGDGHFSKSG-VEIAFHSADHLLAHYIKTR  119
            ++ KL+S H  K  KP    EFG +LAGLID DGH +K G V IAF++ D  +A+YIK+ 
Sbjct  40   ESQKLISIHAPKAKKPQTKEEFGQFLAGLIDSDGHITKDGCVNIAFNTNDISVAYYIKSA  99

Query  120  LGHGKISEVKGKNAIVLRFG---LDGTKEVITLINNKFRTHHRFEQIEKNLFTKPSFSNF  176
            +G+GK++  + K + V+R+    + G  ++  LI  K +   +  Q    L  K      
Sbjct  100  IGYGKVT--REKYSFVVRYSCRPILGLVKIADLIRFKLKHLDKIAQFNSRLVPKL-----  152

Query  177  CNNLDLSLDKSENL-DNYWLSGFSDADASFQI--KILKRSL--TRTEVRLNYQVDQKYDY  231
              N D ++    ++  N+WL+GF   D    +  ++ KR L  T  E R+   + QK + 
Sbjct  153  --NCDPTIYTDSDISQNHWLAGFIQGDGCLSLIQQLDKRRLIGTVPETRIVVAISQKAER  210

Query  232  LLKLIQKELGGNIGHRKSQDTYYYGSTSFVNAVKVIKYFDKYHLMSTKLISYLRWRRAYL  291
            LL LI+   GG + HRK+  TYYY S SF NAVK I Y DK+ LM  KL  Y  WR+AYL
Sbjct  211  LLTLIKAHFGGCVRHRKAHATYYYISNSFTNAVKFINYLDKFQLMGNKLTQYWIWRKAYL  270

Query  292  IIQDRRHLTPKGLEELAESKSSIAKL  317
            I+Q ++HLT KG  ++A+ K++++K+
Sbjct  271  IVQSKQHLTEKGSAKIAQKKANLSKM  296



Lambda      K        H        a         alpha
   0.319    0.134    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 394807164


  Database: /home/ubuntu/.blastDB_temp/Mitochondria_Public_s_aa
    Posted date:  Aug 16, 2017  8:23 PM
  Number of letters in database: 2,445,780
  Number of sequences in database:  9,177



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40